Structure of PDB 8am5 Chain D Binding Site BS01

Receptor Information
>8am5 Chain D (length=278) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
WSGLLLFPCAFMALGGWLTGTTFVTSWYTHGLASSYLEGANFLTVAVSSP
ADAFGHSLLFLWGPEAQGNLTRWFQIGGLWPFVALHGAFGLIGFMLRQFE
ISRLVGIRPYNAIAFSGPIAVFVSVFLMYPLGQSSWFFAPSFGVAGIFRF
ILFLQGFHNWTLNPFHMMGVAGILGGALLCAIHGATVENTLYSMVTANRF
WSQIFGIAFSNKRWLHFFMLFVPVTGLWMSSVGIVGLALNLRAYDFVSQE
LRAAEDPEFETFYTKNILLNEGMRAWMA
Ligand information
>8am5 Chain F (length=28) Species: 1148 (Synechocystis sp. PCC 6803) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VRWLAVHTLAVPSVFFVGAIAAMQFIQR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8am5 The Ycf48 accessory factor occupies the site of the oxygen-evolving manganese cluster during photosystem II biogenesis.
Resolution3.1 Å
Binding residue
(original residue number in PDB)		F42 T50 T53 Y67 L68 E69 G70
Binding residue
(residue number reindexed from 1)		F11 T19 T22 Y36 L37 E38 G39
Enzymatic activity
Enzyme Commision number 1.10.3.9: photosystem II.
Gene Ontology
Molecular Function
GO:0005506 iron ion binding
GO:0009055 electron transfer activity
GO:0010242 oxygen evolving activity
GO:0016168 chlorophyll binding
GO:0016491 oxidoreductase activity
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0009772 photosynthetic electron transport in photosystem II
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0030096 plasma membrane-derived thylakoid photosystem II
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8am5, PDBe:8am5, PDBj:8am5
PDBsum8am5
PubMed37542031
UniProtP09192|PSBD_SYNY3 Photosystem II D2 protein (Gene Name=psbD)

[Back to BioLiP]