Structure of PDB 8a0x Chain D Binding Site BS01

Receptor Information
>8a0x Chain D (length=110) Species: 666 (Vibrio cholerae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMKSVFVESTIFEKYRDEYLSDEEYRLFQAELMLNPKLGDVIQGTGGLRK
IRVASKGKGKRGGSRIIYYFLDEKRRFYLLTIYGKNEMSDLNANQRKQLM
AFMEAWRNEQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8a0x Fuzzy DNA recognition by a prokaryotic transcription factor
Resolution3.296 Å
Binding residue
(original residue number in PDB)		K36 D39 V40 Q42
Binding residue
(residue number reindexed from 1)		K37 D40 V41 Q43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0008150 biological_process
Cellular Component
GO:0005575 cellular_component

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8a0x, PDBe:8a0x, PDBj:8a0x
PDBsum8a0x
PubMed
UniProtQ9KMA6|HIGB2_VIBCH Toxin HigB-2 (Gene Name=higB-2)

[Back to BioLiP]