Structure of PDB 7zzq Chain D Binding Site BS01

Receptor Information
>7zzq Chain D (length=136) Species: 714995 (Novacetimonas hansenii ATCC 23769) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPDFTLFLQTLSWEIDDQVGIEVRNELLREVGRGMGTRIMPPPCQTVDKL
QIELNALLALIGWGTVTLELLSEDQSLRIVHENLPQVGSAGEPSGTWLAP
VLEGLYGRWVTSQDYVVTRDVAVPRQTIIMYMRVRS
Ligand information
>7zzq Chain U (length=15) Species: 714995 (Novacetimonas hansenii ATCC 23769) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DGSPTMAEVFMTLGG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7zzq Bacterial crystalline cellulose secretion via a supramolecular BcsHD scaffold.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q51 T52 V53 D54 L76 S78 Q119 Y126
Binding residue
(residue number reindexed from 1)		Q45 T46 V47 D48 L70 S72 Q113 Y115
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0030244 cellulose biosynthetic process

View graph for
Biological Process
External links
PDB RCSB:7zzq, PDBe:7zzq, PDBj:7zzq
PDBsum7zzq
PubMed36525496
UniProtQ76KJ6

[Back to BioLiP]