Structure of PDB 7zb5 Chain D Binding Site BS01

Receptor Information

>7zb5 Chain D (length=178) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SGITPTLQNIVATVNLDCRLDLKTIALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKLGFNAKFTDFKIQNI
VGSCDIKFPIRLEGLASKHHNFSSYEPELFPGLIYRMIKPKIVLLIFVSG
KIVLTGAKVREEIYQAFEMIYPVLQDFR

Ligand information

>7zb5 Chain A (length=36) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cggccgggcgcccggcatggcggcctataaaagggc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7zb5 Structural basis for TBP displacement from TATA box DNA by the Swi2/Snf2 ATPase Mot1.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	F114 F131 S133 V137 Q173 N174 F205 R211 L220 T230
Binding residue (residue number reindexed from 1)	F39 F56 S58 V62 Q98 N99 F130 R136 L145 T155

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0016251	RNA polymerase II general transcription initiation factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006366	transcription by RNA polymerase II

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zb5, PDBe:7zb5, PDBj:7zb5
PDBsum	7zb5
PubMed	37106137
UniProt	G0SAL6

[Back to BioLiP]