Structure of PDB 7z0q Chain D Binding Site BS01

Receptor Information

>7z0q Chain D (length=176) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QPRFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAVTEL
GRPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRRVHPEVTVYP
AHNLLVCSVSGFYPGSIEVRWFGQEEKAGVVSTGLIQNGDWTFQTLVMLE
TVPEVYTCQVEHPSVMSPLTVEWRAR

Ligand information

>7z0q Chain G (length=14) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

SKMRMATPLLMQAG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7z0q MHC-II dynamics are maintained in HLA-DR allotypes to ensure catalyzed peptide exchange.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	Y13 Y47 W61 R71 Q74 T77 H81 N82 V85
Binding residue (residue number reindexed from 1)	Y10 Y44 W58 R68 Q71 T74 H78 N79 V82

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z0q, PDBe:7z0q, PDBj:7z0q
PDBsum	7z0q
PubMed	37142807
UniProt	D7RIG5

[Back to BioLiP]