Structure of PDB 7yr6 Chain D Binding Site BS01

Receptor Information
>7yr6 Chain D (length=55) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQR
IQKEK
Ligand information
>7yr6 Chain A (length=118) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcguacagggaacacgcaaccccgaaggaucggggaagggacgucgccag
ggaggcgauuccaucaggaugaugacgagggacugaagagugggcggggu
aauaccccgccccuuuuu
<<<<.........>>>>..<<<<<<....>>>>>>........<<<<<..
...>>>>>....<<<.....>>>..<<......>><<<<<.<<<<<<<<<
...>>>>>>>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yr6 Structural basis of sRNA RsmZ regulation of Pseudomonas aeruginosa virulence.
Resolution4.8 Å
Binding residue
(original residue number in PDB)
M1 L2 I3 L4 R31 K38 V42 H43 R44 E46 I47
Binding residue
(residue number reindexed from 1)
M1 L2 I3 L4 R31 K38 V42 H43 R44 E46 I47
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0006109 regulation of carbohydrate metabolic process
GO:0006402 mRNA catabolic process
GO:0006417 regulation of translation
GO:0009372 quorum sensing
GO:0030254 protein secretion by the type III secretion system
GO:0033103 protein secretion by the type VI secretion system
GO:0043455 regulation of secondary metabolic process
GO:0045947 negative regulation of translational initiation
GO:0045948 positive regulation of translational initiation
GO:1900190 regulation of single-species biofilm formation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7yr6, PDBe:7yr6, PDBj:7yr6
PDBsum7yr6
PubMed36828938
UniProtO69078|CSRA_PSEAE Translational regulator CsrA (Gene Name=csrA)

[Back to BioLiP]