Structure of PDB 7yjo Chain D Binding Site BS01

Receptor Information
>7yjo Chain D (length=146) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPGMAWTVVNLAH
FVVTYHSFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTRNRKFLTLVPV
VLYLIASHTTDYRHPWLFLNTLAVMVLVVAKFPNMHKVRIFGINGD
Ligand information
>7yjo Chain E (length=27) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GHFFVEGLLGVVIIILLTRKSYKPPKR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yjo Mechanism of sphingolipid homeostasis revealed by structural analysis of Arabidopsis SPT-ORM1 complex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		Q96 Q97 L98 L107
Binding residue
(residue number reindexed from 1)		Q86 Q87 L88 L97
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006979 response to oxidative stress
GO:0010150 leaf senescence
GO:0030148 sphingolipid biosynthetic process
GO:0034976 response to endoplasmic reticulum stress
GO:0042742 defense response to bacterium
GO:0090156 intracellular sphingolipid homeostasis
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yjo, PDBe:7yjo, PDBj:7yjo
PDBsum7yjo
PubMed36989369
UniProtQ9C5I0

[Back to BioLiP]