Structure of PDB 7yjm Chain D Binding Site BS01

Receptor Information
>7yjm Chain D (length=156) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MANLYVKAVPPPDMNRNTEWFMYPGVWTTYMLILFFGWLVVLSVSGCSPG
MAWTVVNLAHFVVTYHSFHWMKGTPFADDQGIYNGLTWWEQMDNGQQLTR
NRKFLTLVPVVLYLIASHTTDYRHPWLFLNTLAVMVLVVAKFPNMHKVRI
FGINGD
Ligand information
>7yjm Chain E (length=27) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GHFFVEGLLGVVIIILLTRKSYKPPKR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yjm Mechanism of sphingolipid homeostasis revealed by structural analysis of Arabidopsis SPT-ORM1 complex.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q97 L98 K103 L107 L114 H118 Y122
Binding residue
(residue number reindexed from 1)		Q97 L98 K103 L107 L114 H118 Y122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0006979 response to oxidative stress
GO:0010150 leaf senescence
GO:0030148 sphingolipid biosynthetic process
GO:0034976 response to endoplasmic reticulum stress
GO:0042742 defense response to bacterium
GO:0090156 intracellular sphingolipid homeostasis
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yjm, PDBe:7yjm, PDBj:7yjm
PDBsum7yjm
PubMed36989369
UniProtQ9C5I0

[Back to BioLiP]