Structure of PDB 7yi6 Chain D Binding Site BS01

Receptor Information
>7yi6 Chain D (length=221) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PVQLVQSGSELKKPGASVRISCKASGYSFTSLSMNWVRQAPGQGLEWMGW
ISTKSGDPTYAQAFTGRFVFSLDTSVNTAYLQINSLEAGDTAVYYCARGQ
PPVGWTFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKKVEPP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yi6 Cross-reactive epitopes between HIV and Coronavirus revealed by 3D1
Resolution2.28 Å
Binding residue
(original residue number in PDB)		L32 S33 N35 W50 S52 T53 K54 P102 V103 G104 W105
Binding residue
(residue number reindexed from 1)		L32 S33 N35 W50 S52 T53 K54 P102 V103 G104 W105
External links