Structure of PDB 7yi4 Chain D Binding Site BS01

Receptor Information
>7yi4 Chain D (length=316) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TISEDSKVSVTGLPLNKGPSEKIKRESLWNDLKTFLTENMTEESNIRSTI
GWNEDFCSACNQSGSFLCCDTCPKSFHFLCLDPPIDPNNLPKGDWHCNEC
KFKIFINNSMATLKKIESNFIKQNNNVKIFAKLLFNIDSHNPKQFQLPNY
IKETFPAVKTGSRGQYSDENDKSYNPDTHIDSNSGKFLICYKCNQTRLGS
WSHPENSRLIMTCDYCQTPWHLDCVPRASFKNLGSKWKCPLHSPTKVYKK
YKVWKKQRLINKKNQLYYEPLQKIGYQNNGNIQIINQDFKITQIDENSIK
YDFFDKIYKSKMVQKR
Ligand information
>7yi4 Chain F (length=20) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
NSIKYDFFDKIYKSKMVQKR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7yi4 Diverse modes of H3K36me3-guided nucleosomal deacetylation by Rpd3S.
Resolution3.96 Å
Binding residue
(original residue number in PDB)		K548 F552 Y556
Binding residue
(residue number reindexed from 1)		K300 F304 Y308
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000122 negative regulation of transcription by RNA polymerase II
GO:0006325 chromatin organization
GO:0006334 nucleosome assembly
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0030174 regulation of DNA-templated DNA replication initiation
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0060195 negative regulation of antisense RNA transcription
Cellular Component
GO:0000118 histone deacetylase complex
GO:0005634 nucleus
GO:0032221 Rpd3S complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yi4, PDBe:7yi4, PDBj:7yi4
PDBsum7yi4
PubMed37468628
UniProtQ04779|RCO1_YEAST Transcriptional regulatory protein RCO1 (Gene Name=RCO1)

[Back to BioLiP]