Structure of PDB 7y65 Chain D Binding Site BS01

Receptor Information
>7y65 Chain D (length=283) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLRVPDILALVIFAVVFLVGVLGNALVVWVTAFEAKRTINAIWFLNLAVA
DFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNMYASILLLATIS
ADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREEY
FPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWS
RRATRSTKTLKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKL
DSLCVSFAYINCCINPIIYVVAGQGFQGRLRKS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7y65 Mechanism of activation and biased signaling in complement receptor C5aR1.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		L92 P113 R178 L187 C188 G189 D191 E199 Y258 K279 D282
Binding residue
(residue number reindexed from 1)		L61 P82 R147 L156 C157 G158 D160 E168 Y227 K248 D251
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004875 complement receptor activity
GO:0004878 complement component C5a receptor activity
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0001774 microglial cell activation
GO:0002430 complement receptor mediated signaling pathway
GO:0002682 regulation of immune system process
GO:0006935 chemotaxis
GO:0006954 inflammatory response
GO:0006955 immune response
GO:0006968 cellular defense response
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007204 positive regulation of cytosolic calcium ion concentration
GO:0007606 sensory perception of chemical stimulus
GO:0010575 positive regulation of vascular endothelial growth factor production
GO:0010759 positive regulation of macrophage chemotaxis
GO:0030593 neutrophil chemotaxis
GO:0032494 response to peptidoglycan
GO:0038178 complement component C5a signaling pathway
GO:0042789 mRNA transcription by RNA polymerase II
GO:0045766 positive regulation of angiogenesis
GO:0048143 astrocyte activation
GO:0050679 positive regulation of epithelial cell proliferation
GO:0050830 defense response to Gram-positive bacterium
GO:0050890 cognition
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0090023 positive regulation of neutrophil chemotaxis
GO:0097242 amyloid-beta clearance
GO:0099172 presynapse organization
GO:1902947 regulation of tau-protein kinase activity
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0016323 basolateral plasma membrane
GO:0030667 secretory granule membrane
GO:0031410 cytoplasmic vesicle
GO:0045177 apical part of cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7y65, PDBe:7y65, PDBj:7y65
PDBsum7y65
PubMed36806352
UniProtP21730|C5AR1_HUMAN C5a anaphylatoxin chemotactic receptor 1 (Gene Name=C5AR1)

[Back to BioLiP]