Structure of PDB 7xvn Chain D Binding Site BS01

Receptor Information
>7xvn Chain D (length=69) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQVAYSCTRQQNCPIDRTS
RNRCQHCRLQKCLALGMSR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xvn Structural basis for DNA recognition feature of retinoid-related orphan receptors
Resolution2.302 Å
Binding residue
(original residue number in PDB)		E49 R57 R80 N81 Q84 R87
Binding residue
(residue number reindexed from 1)		E22 R30 R51 N52 Q55 R58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xvn, PDBe:7xvn, PDBj:7xvn
PDBsum7xvn
PubMed38309263
UniProtP51450|RORG_MOUSE Nuclear receptor ROR-gamma (Gene Name=Rorc)

[Back to BioLiP]