Structure of PDB 7xqu Chain D Binding Site BS01

Receptor Information
>7xqu Chain D (length=272) Species: 9685 (Felis catus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SHSLRYFYTAISRPGLGEPRFISVGYVDDTQFVRFDSDAPNPREEPRAPW
MEQEGPEYWDRNTRIYLDTAQIFRVDLNTMLRYYNQSESGSHNIQRMYGC
DVEPDRLLRGYSQDSYDGKDYIALNEDLRSWTAADTAAQITRRKWEEAGV
AERWRNYLEGLCVESLAKYLDMGKETLLRAESPNTRVTRHPISDREVTLR
CWALGFYPAEITLTWQRDGQDHTQDTELVETRPAGDGTFQKWAAVVVPSG
EEQRYTCHVQHKGLPEPINLRW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xqu Analysis of the characteristics of feline major histocompatibility complex class I molecules cross-presenting coronavirus peptides
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Y7 Y59 R62 N63 I66 Y67 I73 D77 M81 Y84 Y99 D116 T143 K146 W147 R155 W156 Y159 S167 Y171
Binding residue
(residue number reindexed from 1)		Y6 Y58 R61 N62 I65 Y66 I72 D76 M80 Y83 Y98 D114 T141 K144 W145 R153 W154 Y157 S165 Y169
Enzymatic activity
Enzyme Commision number ?
External links