Structure of PDB 7xfi Chain D Binding Site BS01

Receptor Information
>7xfi Chain D (length=92) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>7xfi Chain I (length=136) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tatatctgacacgggcctggagactagggagtaatccccttggcggttaa
aacgcgggggacagcgcgtacgtgcgtttaagcggtgctagagctgtcta
cgaccaattgagcggcctcggcaccgggattctcca
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7xfi Structure of nucleosome-DI complex (-50I, Apo state)
Resolution2.9 Å
Binding residue
(original residue number in PDB)		S52 S53 R83 S84 T85
Binding residue
(residue number reindexed from 1)		S23 S24 R54 S55 T56
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7xfi, PDBe:7xfi, PDBj:7xfi
PDBsum7xfi
PubMed37339965
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]