Structure of PDB 7x5l Chain D Binding Site BS01

Receptor Information

>7x5l Chain D (length=169) Species: 4006 (Linum usitatissimum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VEYDVFLSFRGPDTRKQFTDFLYHFLCYYKIHTFRDDDELRKGKEIGPNL
LRAIDQSKIYVPIISSGYADSKWCLMELAEIVRRQEEDPRRIILPIFYMV
DPSDVRHQTGCYKKAFRKHANKFDGQTIQNWKDALKKVGDLKGWHIGKDD
EQGAIADKVSADIWSHISK

Ligand information

>7x5l Chain A (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ataaatta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7x5l TIR domains of plant immune receptors are 2',3'-cAMP/cGMP synthetases mediating cell death.
Resolution	3.51 Å
Binding residue (original residue number in PDB)	K172 R175 K176
Binding residue (residue number reindexed from 1)	K114 R117 K118

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0007165	signal transduction

View graph for
Biological Process

External links

PDB	RCSB:7x5l, PDBe:7x5l, PDBj:7x5l
PDBsum	7x5l
PubMed	35597242
UniProt	Q9XEH4

[Back to BioLiP]