Structure of PDB 7wt5 Chain D Binding Site BS01

Receptor Information
>7wt5 Chain D (length=243) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRA
PWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMF
GCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEA
AHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHHHPRCWALGFY
PAEITLTWQRELVETRPAGDGTFQKWAAVYTCHVQHEGLPKPL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wt5 Crystal structures of N-myristoylated lipopeptide-bound HLA class I complexes indicate reorganization of B-pocket architecture upon ligand binding.
Resolution2.09508 Å
Binding residue
(original residue number in PDB)		Y7 Y59 E63 K66 H70 T73 E76 N77 I80 Y84 L95 F99 Y116 Y123 T143 K146 Q155 Q156 Y159 R170 Y171
Binding residue
(residue number reindexed from 1)		Y8 Y60 E64 K67 H71 T74 E77 N78 I81 Y85 L96 F100 Y117 Y124 T144 K147 Q156 Q157 Y160 R171 Y172
Enzymatic activity
Enzyme Commision number ?
External links