Structure of PDB 7wt3 Chain D Binding Site BS01

Receptor Information
>7wt3 Chain D (length=210) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AGSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRA
PWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMF
GCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEA
AHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDRCWAYPAEITLLVETR
PAGDGTFQKW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7wt3 Crystal structures of N-myristoylated lipopeptide-bound HLA class I complexes indicate reorganization of B-pocket architecture upon ligand binding.
Resolution1.88766 Å
Binding residue
(original residue number in PDB)		Y7 A24 H70 E76 N77 I80 Y84 L95 Y123 T143 K146 W147
Binding residue
(residue number reindexed from 1)		Y8 A25 H71 E77 N78 I81 Y85 L96 Y124 T144 K147 W148
Enzymatic activity
Enzyme Commision number ?
External links