Structure of PDB 7v90 Chain D Binding Site BS01

Receptor Information
>7v90 Chain D (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGE
ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
Ligand information
>7v90 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggttagggttagggttagggttagggttagggttagggttagggttagg
gttagggttagggttagggttagggttagggttagggttagggttagggt
tagggttagggttagggttagggttagggttagggttagggttag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v90 Columnar structure of human telomeric chromatin.
Resolution3.5 Å
Binding residue
(original residue number in PDB)		R26 K27 R28 R30 I51 T85
Binding residue
(residue number reindexed from 1)		R3 K4 R5 R7 I28 T62
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7v90, PDBe:7v90, PDBj:7v90
PDBsum7v90
PubMed36104563
UniProtO60814|H2B1K_HUMAN Histone H2B type 1-K (Gene Name=H2BC12)

[Back to BioLiP]