Structure of PDB 7v00 Chain D Binding Site BS01

Receptor Information
>7v00 Chain D (length=199) Species: 176279 (Staphylococcus epidermidis RP62A) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YSKIKISGTIEVVTGLHIGGGGDSPVVRDLQTKLPIIPGSSIKGKMRNLL
AKHFGLKMKQESHNQDDERVLRLFGSSEKGNIQRARLQISDAFFSEKTKE
HFAQNDIAYTETKFENTINRLTAVANPRQIERVTRGSEFDFVFIYNVDEE
SQVEDDFENIEKAIHLLENDYLGGGGTRGNGRIQFKDTNIETVVGEYDS
Ligand information
>7v00 Chain G (length=30) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acgagaacuaguaauaauugucauuugcau
..............................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7v00 Structures of an active type III-A CRISPR effector complex.
Resolution3.87 Å
Binding residue
(original residue number in PDB)
I19 G20 G21 S49 K52 G53 K54 R56 N57 G84 S85 R137 G182 G183 T186 R187
Binding residue
(residue number reindexed from 1)
I18 G19 G20 S40 K43 G44 K45 R47 N48 G75 S76 R128 G173 G174 T177 R178
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0051607 defense response to virus

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:7v00, PDBe:7v00, PDBj:7v00
PDBsum7v00
PubMed35714601
UniProtQ5HK91

[Back to BioLiP]