Structure of PDB 7uy6 Chain D Binding Site BS01

Receptor Information
>7uy6 Chain D (length=187) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGK
SVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQL
INQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENK
EFNNEQEIAYKVLKIEKENIKEESKYLLKKLEHLINN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uy6 Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
Resolution2.9 Å
Binding residue
(original residue number in PDB)		R554 M586 M601 F603 K660 F662
Binding residue
(residue number reindexed from 1)		R44 M76 M91 F93 K150 F152
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding
GO:0043047 single-stranded telomeric DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0007004 telomere maintenance via telomerase
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uy6, PDBe:7uy6, PDBj:7uy6
PDBsum7uy6
PubMed35831498
UniProtD2CVN6|TEB1_TETTS Telomeric repeat-binding subunit 1 (Gene Name=TEB1)

[Back to BioLiP]