Structure of PDB 7ui9 Chain D Binding Site BS01

Receptor Information
>7ui9 Chain D (length=169) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRS
QKKHKADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFS
RFRDQETVGAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKI
SDDELERILKELSNLETLY
Ligand information
>7ui9 Chain z (length=25) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PSYSPTSPSYSPTSPSYSPTSPSYS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ui9 Structural basis of a transcription pre-initiation complex on a divergent promoter.
Resolution3.3 Å
Binding residue
(original residue number in PDB)
G161 I164 Q165 K168
Binding residue
(residue number reindexed from 1)
G109 I112 Q113 K116
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0003697 single-stranded DNA binding
GO:0003727 single-stranded RNA binding
GO:0003968 RNA-dependent RNA polymerase activity
GO:0005515 protein binding
GO:0031369 translation initiation factor binding
Biological Process
GO:0000288 nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0001172 RNA-templated transcription
GO:0006352 DNA-templated transcription initiation
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0006397 mRNA processing
GO:0044237 cellular metabolic process
GO:0045948 positive regulation of translational initiation
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0000932 P-body
GO:0005634 nucleus
GO:0005665 RNA polymerase II, core complex
GO:0005737 cytoplasm
GO:0030880 RNA polymerase complex
GO:1990328 RPB4-RPB7 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7ui9, PDBe:7ui9, PDBj:7ui9
PDBsum7ui9
PubMed36731470
UniProtP20433|RPB4_YEAST DNA-directed RNA polymerase II subunit RPB4 (Gene Name=RPB4)

[Back to BioLiP]