Structure of PDB 7uhy Chain D Binding Site BS01

Receptor Information
>7uhy Chain D (length=288) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AYGSYQDANIPFPRTSGARFCGAGYLVYFTRPMAAGKVIIQDIACLLPVH
KSLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGP
KSDPDLETPWARHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRDP
RERERDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFV
SCPPDPHKGIEFGVYCSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSN
FCLTCGHGGHTSHMMEWFRTQEVCPTGCGCHCLLESTF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uhy Structure of the nutrient-sensing hub GATOR2.
Resolution3.66 Å
Binding residue
(original residue number in PDB)		G527 D531 A532 I534 P535 F536
Binding residue
(residue number reindexed from 1)		G3 D7 A8 I10 P11 F12
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035591 signaling adaptor activity
GO:0046872 metal ion binding
Biological Process
GO:0031669 cellular response to nutrient levels
GO:0034198 cellular response to amino acid starvation
GO:1904262 negative regulation of TORC1 signaling
GO:1904263 positive regulation of TORC1 signaling
Cellular Component
GO:0005764 lysosome
GO:0005765 lysosomal membrane
GO:0005774 vacuolar membrane
GO:0005829 cytosol
GO:0016020 membrane
GO:0035859 Seh1-associated complex
GO:0043231 intracellular membrane-bounded organelle
GO:0061700 GATOR2 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uhy, PDBe:7uhy, PDBj:7uhy
PDBsum7uhy
PubMed35831510
UniProtQ6PJI9|WDR59_HUMAN GATOR2 complex protein WDR59 (Gene Name=WDR59)

[Back to BioLiP]