Structure of PDB 7u4d Chain D Binding Site BS01

Receptor Information

>7u4d Chain D (length=92) Species: 9606 (Homo sapiens)

RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAH
YNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSS

Ligand information

>7u4d Chain I (length=139)

gagaatccggtgccgaggccgctcaattggtcgtagacagctctagcacc
gcttaaacgcacgtacgcgctgtcccccgcgttttaaccgccaaggggat
tactccctagtctccaggcacgtgtcagatatatacatc

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7u4d CENP-N promotes the compaction of centromeric chromatin.
• Resolution: 8.1 Å
• Binding residue (original residue number in PDB): Y42 I54 S56 R86 S87 T88
• Binding residue (residue number reindexed from 1): Y10 I22 S24 R54 S55 T56

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0030527 structural constituent of chromatin
• GO:0042802 identical protein binding
• GO:0046982 protein heterodimerization activity

Biological Process

• GO:0002227 innate immune response in mucosa
• GO:0006334 nucleosome assembly
• GO:0019731 antibacterial humoral response
• GO:0042742 defense response to bacterium
• GO:0050830 defense response to Gram-positive bacterium
• GO:0061844 antimicrobial humoral immune response mediated by antimicrobial peptide

Cellular Component

• GO:0000786 nucleosome
• GO:0005615 extracellular space
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005829 cytosol
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:7u4d, PDBe:7u4d, PDBj:7u4d
• PDBsum: 7u4d
• PubMed: 35422519
• UniProt: P62807|H2B1C_HUMAN Histone H2B type 1-C/E/F/G/I (Gene Name=H2BC4)