Structure of PDB 7tve Chain D Binding Site BS01

Receptor Information
>7tve Chain D (length=445) Species: 580240 (Saccharomyces cerevisiae W303) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EESPSGYIKKVILRNFMCHEHFELELGSRLNFIVGNNGSGKSAILTAITI
GLGAKASETNRGSSLKDLIREGCYSAKIILHLDNSKYGAYQQGIFGNEII
VERIIKRDGPASFSLRSENGKEISNKKKDIQTVVDYFSVPVSNPMCFLSQ
DAARSFLTASTSQDKYSHFMKGTLLQEITENLLYASAIHDSAQENMALHL
ENLKSLKAEYEDAKKLLRELNQTSDLNERKMLLQAKSLDTQEEIKRELDK
VSRMIQKAEKSLGLSQEEVIALFEKCRNKYKEGQKKYMEIDEALNRLHNS
LKARDQNYKNAEKGTCFDADMDFRASLKVRKFSGNLSFIKDTKSLEIYIL
TTNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDQFDVFMDQV
NRKIGTTLIVKKLKDIARTQTIIITPQDIGKIADIDSSGVSIHRM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tve Cryo-EM structure of DNA-bound Smc5/6 reveals DNA clamping enabled by multi-subunit conformational changes.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		K129 S138 F187
Binding residue
(residue number reindexed from 1)		K55 S64 F113
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
GO:0019789 SUMO transferase activity
Biological Process
GO:0000724 double-strand break repair via homologous recombination
GO:0006281 DNA repair
GO:0006302 double-strand break repair
GO:0006310 DNA recombination
GO:0016925 protein sumoylation
GO:0032204 regulation of telomere maintenance
GO:0051304 chromosome separation
GO:0071139 resolution of DNA recombination intermediates
GO:0140588 chromatin looping
GO:1990683 DNA double-strand break attachment to nuclear envelope
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005739 mitochondrion
GO:0030915 Smc5-Smc6 complex
GO:0035861 site of double-strand break

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tve, PDBe:7tve, PDBj:7tve
PDBsum7tve
PubMed35648833
UniProtQ12749|SMC6_YEAST Structural maintenance of chromosomes protein 6 (Gene Name=SMC6)

[Back to BioLiP]