Structure of PDB 7tt7 Chain D Binding Site BS01

Receptor Information
>7tt7 Chain D (length=102) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TNMALDDSALQGFFGVDRSDRDPQHARAAFSKRLVFLKDRLAKYEYSVAE
YYTERGAWVAVVNRVEGMLRDYPDTQATRDALPAYRQMQMNAVAKIIAAN
SS
Ligand information
>7tt7 Chain C (length=28) Species: 562 (Escherichia coli) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DEAYLEAAPLAELHAPALPVTSGDYAIP
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tt7 Cryo-EM structures reveal multiple stages of bacterial outer membrane protein folding.
Resolution4.8 Å
Binding residue
(original residue number in PDB)		F144 V168 K171 R203 D204 D207 T211 R212 K236 I237 A240 N241
Binding residue
(residue number reindexed from 1)		F30 V35 K38 R70 D71 D74 T78 R79 K95 I96 A99 N100
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
Biological Process
GO:0043165 Gram-negative-bacterium-type cell outer membrane assembly
GO:0051205 protein insertion into membrane
Cellular Component
GO:0009279 cell outer membrane
GO:0016020 membrane
GO:1990063 Bam protein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7tt7, PDBe:7tt7, PDBj:7tt7
PDBsum7tt7
PubMed35294859
UniProtP0AC02|BAMD_ECOLI Outer membrane protein assembly factor BamD (Gene Name=bamD)

[Back to BioLiP]