Structure of PDB 7tn2 Chain D Binding Site BS01

Receptor Information
>7tn2 Chain D (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RRKTRKESYAIYVYKVLKQVHPDTGISCKAMSIMNSFVNDVFERIAGEAS
RLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA
Ligand information
>7tn2 Chain I (length=160) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgccctggagaatcccggtgccgaggccgctcaattggtcgtagacagc
tctagcaaccgcttaaacgcacgtacgcgctgtcccccgcgttttaaccg
ccaaggggattactccctagtctccaggcacgtgtcagatatatacatcc
tgtgcatgta
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7tn2 Nucleosome recognition and DNA distortion by the Chd1 remodeler in a nucleotide-free state.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R26 T29 Y39 I51 C53 S84 T85
Binding residue
(residue number reindexed from 1)		R1 T4 Y14 I26 C28 S59 T60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7tn2, PDBe:7tn2, PDBj:7tn2
PDBsum7tn2
PubMed35173352
UniProtP02281|H2B11_XENLA Histone H2B 1.1

[Back to BioLiP]