Structure of PDB 7sp1 Chain D Binding Site BS01

Receptor Information

>7sp1 Chain D (length=36) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLA

Ligand information

>7sp1 Chain Q (length=10) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

aaaaaaaaaa

..........

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7sp1 Cryo-EM structure of RNA-induced tau fibrils reveals a small C-terminal core that may nucleate fibril formation.
Resolution	3.4 Å
Binding residue (original residue number in PDB)	R406 H407 P423
Binding residue (residue number reindexed from 1)	R16 H17 P33

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0008017	microtubule binding
GO:0015631	tubulin binding

View graph for
Molecular Function

External links

PDB	RCSB:7sp1, PDBe:7sp1, PDBj:7sp1
PDBsum	7sp1
PubMed	35377792
UniProt	P10636\|TAU_HUMAN Microtubule-associated protein tau (Gene Name=MAPT)

[Back to BioLiP]