Structure of PDB 7rly Chain D Binding Site BS01

Receptor Information
>7rly Chain D (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVMTQTPLSLSVTIGQPASISCKSSQSLLHSNGKTYLNWLQQRPGQAPK
ILMYLVSKLDPGIPDRFSGSGSETDFTLKISRVEAEDLGVYYCLQGTYYP
FTFGSGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
VQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACE
VTHQGLSSPVTKSFNRGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rly Structural basis of Plasmodium vivax inhibition by antibodies binding to the circumsporozoite protein repeats.
Resolution2.67 Å
Binding residue
(original residue number in PDB)		H27D Y32 N34 G91 T92 Y93 Y94 F96
Binding residue
(residue number reindexed from 1)		H31 Y37 N39 G96 T97 Y98 Y99 F101
External links