Structure of PDB 7rk7 Chain D Binding Site BS01

Receptor Information
>7rk7 Chain D (length=189) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LAKTTQPISMDSYEGQEVNITCSHNNIATNDYITWYQQFPSQGPRFIIQG
YKTKVTNEVASLFIPADRKSSTLSLPRVSLSDTAVYYCLVALNYGGSQGN
LIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQS
KDSDVYITDKCVLDMRSMDFKSNSAVAWSNKFACANAFN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7rk7 The complex between TIL 1383i TCR and human Class I MHC HLA-A2 with the bound Tyrosinase(369-377)(N371D) nonameric peptide
Resolution2.54 Å
Binding residue
(original residue number in PDB)		N37 N100 Y101 G102 Q105
Binding residue
(residue number reindexed from 1)		N30 N93 Y94 G95 Q98
External links