Structure of PDB 7qpb Chain D Binding Site BS01

Receptor Information
>7qpb Chain D (length=104) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDR
APVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLK
AITY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qpb Display Selection of a Hybrid Foldamer-Peptide Macrocycle.
Resolution2.342 Å
Binding residue
(original residue number in PDB)		Y753 D754 K801 F821 V823
Binding residue
(residue number reindexed from 1)		Y12 D13 K60 F80 V82
Enzymatic activity
Enzyme Commision number 2.3.2.26: HECT-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000209 protein polyubiquitination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7qpb, PDBe:7qpb, PDBj:7qpb
PDBsum7qpb
PubMed37707879
UniProtQ05086|UBE3A_HUMAN Ubiquitin-protein ligase E3A (Gene Name=UBE3A)

[Back to BioLiP]