Structure of PDB 7qi1 Chain D Binding Site BS01

Receptor Information
>7qi1 Chain D (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGSMTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLS
VAYKNVVGARRSSWRVISSIEQKTNEKKQQMGKEYREKIEAELQDICNDV
LELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQ
AYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFD
EAIAELDTLNEESYKDSTLIMQLLRDNLTLWTS
Ligand information
>7qi1 Chain F (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ILPRISVISTGRRRQSVLNLMT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7qi1 Macrocycle-stabilization of its interaction with 14-3-3 increases plasma membrane localization and activity of CFTR.
Resolution1.76 Å
Binding residue
(original residue number in PDB)		N40 R43 N44 V48 R58 R62 K122 R129 Y130 P167 I168 L174 N175 V178 E182 L222 N226 L229
Binding residue
(residue number reindexed from 1)		N43 R46 N47 V51 R61 R65 K123 R130 Y131 P168 I169 L175 N176 V179 E183 L223 N227 L230
Enzymatic activity
Enzyme Commision number ?
External links