Structure of PDB 7q99 Chain D Binding Site BS01

Receptor Information
>7q99 Chain D (length=198) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYS
NGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNVAGKSTFGDG
TTLTVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVY
ITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7q99 Targeting of multiple tumor-associated antigens by individual T cell receptors during successful cancer immunotherapy.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		Q31 S32 N92
Binding residue
(residue number reindexed from 1)		Q29 S30 N90
External links