Structure of PDB 7pel Chain D Binding Site BS01

Receptor Information

>7pel Chain D (length=258) Species: 33747 (Simian T-lymphotropic virus 1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPAKLHSFTHCGQAALTLHGATTTEALNILHSCHACRIRRGLLPNHIWQG
DITHFKYKNTLYRLHVWVDTFSGSVSATHKKRETSSEAISSLLHAIAHLG
RPSHINTDNGPAYASQEFQHACTSLAIRHTTHIPVERTNGILKTLLYKYF
SDNPNLPMDNALSVALWTINHLNVLTHCQKTRWQLHHSPRLPPIPEAKPV
TTSKTHWYYFKIPGLNSRQWKGPQRALQEAAGAALIPVSDTAAQWIPWKL
LKRAVCPR

Ligand information

>7pel Chain K (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

actgtgtttggcgcttctctc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7pel Cryo-EM structure of the deltaretroviral intasome in complex with the PP2A regulatory subunit B56gamma.
Resolution	3.34 Å
Binding residue (original residue number in PDB)	S239 Q241
Binding residue (residue number reindexed from 1)	S217 Q219

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0008270	zinc ion binding

	Biological Process
GO:0015074	DNA integration

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:7pel, PDBe:7pel, PDBj:7pel
PDBsum	7pel
PubMed	33028863
UniProt	Q4QY51

[Back to BioLiP]