Structure of PDB 7pbu Chain D Binding Site BS01

Receptor Information
>7pbu Chain D (length=133) Species: 90371 (Salmonella enterica subsp. enterica serovar Typhimurium) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VIGRLRGIILEKQPPIVLLETGGVGYEVHMPMTCFYELPEAGQEAIVFTH
FVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVN
AVEREELGALVKLPGIGKKTAERLIVEMKDRFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7pbu Mechanism of AAA+ ATPase-mediated RuvAB-Holliday junction branch migration.
Resolution3.3 Å
Binding residue
(original residue number in PDB)		N79 G80 G82
Binding residue
(residue number reindexed from 1)		N79 G80 G82
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003678 DNA helicase activity
GO:0005524 ATP binding
GO:0009378 four-way junction helicase activity
Biological Process
GO:0006281 DNA repair
GO:0006310 DNA recombination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7pbu, PDBe:7pbu, PDBj:7pbu
PDBsum7pbu
PubMed36002576
UniProtA0A0M0QTS9

[Back to BioLiP]