Structure of PDB 7p33 Chain D Binding Site BS01

Receptor Information
>7p33 Chain D (length=156) Species: 10377 (Human herpesvirus 4 strain B95-8) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRY
HVLLEEIIERNSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGR
ALAWMAWCMHACRTLCCNQSTPYYVVDLSVRGMLEASEGLDGWIHQQGGW
STLIED
Ligand information
>7p33 Chain I (length=23) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
QEDIIRNIARHLAQVGDSMDRSI
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p33 Crystal Structures of Epstein-Barr Virus Bcl-2 Homolog BHRF1 Bound to Bid and Puma BH3 Motif Peptides.
Resolution2.78543 Å
Binding residue
(original residue number in PDB)		N61 H75 D82 S85 E89 G99 R100 A103 W107
Binding residue
(residue number reindexed from 1)		N61 H75 D82 S85 E89 G99 R100 A103 W107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0042981 regulation of apoptotic process

View graph for
Biological Process
External links
PDB RCSB:7p33, PDBe:7p33, PDBj:7p33
PDBsum7p33
PubMed36298777
UniProtP03182|EAR_EBVB9 Apoptosis regulator BHRF1 (Gene Name=BHRF1)

[Back to BioLiP]