Structure of PDB 7p0m Chain D Binding Site BS01

Receptor Information
>7p0m Chain D (length=531) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTR
NYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQ
LRGSTQGKILCFYGPPGVGKTSIARSIARALNREYFRFSVGGMTDVAEIK
GHRRTYVGAMPGKIIQCLKKTKTENPLILIDEVDKIGRGYQGDPSSALLE
LLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVS
GYVAQEKLAIAERYLVPQARALCGLDESKAKLSSDVLTLLIKQYCRESGV
RNLQKQVEKVLRKSAYKIVSGEAESVEVTPENLQDFVGKPVFTVERMYDV
TPPGVVMGLAWTAMGGSTLFVETSLRRKDGSLEVTGQLGEVMKESARIAY
TFARAFLMQHAPANDYLVTSHIHLHVPEGATPKDGPSAGCTIVTALLSLA
MGRPVRQNLAMTGEVSLTGKILPVGGIKEATIAAKRAGVTCIVLPAENKK
DFYDLAAFITEGLEVHFVEHYREIFDIAFPD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7p0m A dual allosteric pathway drives human mitochondrial Lon
Resolution2.75 Å
Binding residue
(original residue number in PDB)		A769 W770 T771 M810 P850 K851 D852 S855 A856
Binding residue
(residue number reindexed from 1)		A360 W361 T362 M392 P432 K433 D434 S437 A438
Enzymatic activity
Enzyme Commision number 3.4.21.53: endopeptidase La.
Gene Ontology
Molecular Function
GO:0001018 mitochondrial promoter sequence-specific DNA binding
GO:0003677 DNA binding
GO:0003697 single-stranded DNA binding
GO:0003727 single-stranded RNA binding
GO:0004176 ATP-dependent peptidase activity
GO:0004252 serine-type endopeptidase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008236 serine-type peptidase activity
GO:0016887 ATP hydrolysis activity
GO:0042731 PH domain binding
GO:0042802 identical protein binding
GO:0043531 ADP binding
GO:0043560 insulin receptor substrate binding
GO:0043565 sequence-specific DNA binding
GO:0051880 G-quadruplex DNA binding
GO:0070182 DNA polymerase binding
Biological Process
GO:0000002 mitochondrial genome maintenance
GO:0001666 response to hypoxia
GO:0006508 proteolysis
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins
GO:0007005 mitochondrion organization
GO:0030163 protein catabolic process
GO:0032042 mitochondrial DNA metabolic process
GO:0034599 cellular response to oxidative stress
GO:0035694 mitochondrial protein catabolic process
GO:0046627 negative regulation of insulin receptor signaling pathway
GO:0051131 chaperone-mediated protein complex assembly
GO:0051603 proteolysis involved in protein catabolic process
GO:0070407 oxidation-dependent protein catabolic process
Cellular Component
GO:0005654 nucleoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol
GO:0016020 membrane
GO:0042645 mitochondrial nucleoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p0m, PDBe:7p0m, PDBj:7p0m
PDBsum7p0m
PubMed
UniProtP36776|LONM_HUMAN Lon protease homolog, mitochondrial (Gene Name=LONP1)

[Back to BioLiP]