Structure of PDB 7ntk Chain D Binding Site BS01

Receptor Information
>7ntk Chain D (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGD
EVLEINGIEIRGKDVNEVFDLLSDMHGTLTFVLIPS
Ligand information
>7ntk Chain E (length=7) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RVPDLLV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ntk Structural basis of coronavirus E protein interactions with human PALS1 PDZ domain.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		P266 L267 A269 T270 V271 R272 S281 R282 V314 F318
Binding residue
(residue number reindexed from 1)		P17 L18 A20 T21 V22 R23 S32 R33 V65 F69
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7ntk, PDBe:7ntk, PDBj:7ntk
PDBsum7ntk
PubMed34117354
UniProtQ8N3R9|PALS1_HUMAN Protein PALS1 (Gene Name=PALS1)

[Back to BioLiP]