Structure of PDB 7nmg Chain D Binding Site BS01

Receptor Information
>7nmg Chain D (length=192) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GEDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGLQLLTYIF
SNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAEPSGNTGKLI
FGQGTTLQVKPIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDS
DVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSII
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nmg Human MHC Class I, A24 Allele presenting LWM, Complex with 4C6 TCR
Resolution2.48 Å
Binding residue
(original residue number in PDB)		S29 S30 P93 S94 G95 N96
Binding residue
(residue number reindexed from 1)		S28 S29 P92 S93 G94 N95
External links