Structure of PDB 7n1f Chain D Binding Site BS01

Receptor Information
>7n1f Chain D (length=197) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIY
SNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLCAVNRDDKIIFGK
GTRLHILPNIQNPDPAVYQLRDSKSDKSVCLFTDFDSQTNVSQSKDSDVY
ITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Ligand information
>7n1f Chain C (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YLQPRTFLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n1f Structural assessment of HLA-A2-restricted SARS-CoV-2 spike epitopes recognized by public and private T-cell receptors.
Resolution2.393 Å
Binding residue
(original residue number in PDB)		Q31 N92 D94 D95
Binding residue
(residue number reindexed from 1)		Q30 N91 D93 D94
External links