Structure of PDB 7n1a Chain D Binding Site BS01

Receptor Information
>7n1a Chain D (length=273) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSAGSHTVQRMYGC
DVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAH
VAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATL
RCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPS
GQEQRYTCHVQHEGLPKPLTLRW
Ligand information
>7n1a Chain F (length=9) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YLQPRTFLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7n1a Structural assessment of HLA-A2-restricted SARS-CoV-2 spike epitopes recognized by public and private T-cell receptors.
Resolution2.065 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 V67 T73 D77 L81 Y84 Y99 H114 Y116 T143 K146 W147 V152 L156 Y159 T163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 V67 T73 D77 L81 Y84 Y98 H113 Y115 T142 K145 W146 V151 L155 Y158 T162 W166 Y170
Enzymatic activity
Enzyme Commision number ?
External links