Structure of PDB 7lv9 Chain D Binding Site BS01

Receptor Information
>7lv9 Chain D (length=89) Species: 694581 (Marseillevirus marseillevirus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NFRLGLRNMLAQIHPDISVQTEALSELSNIAVFLGKKISHGAVTLLPEGT
KTIKSSAVLLAAGDLYGKDLGRHAVGEMTKAVTRYGSAK
Ligand information
>7lv9 Chain H (length=95) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atctgacacgtgcctggagactagggagtaatccccttggcggttaaaac
gcgggggagaatccgtacgtgcgtttaagcggtgctagagctgtc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lv9 The structure of a virus-encoded nucleosome.
Resolution4.5 Å
Binding residue
(original residue number in PDB)		Q35 T36 T65 K66 T67 K69
Binding residue
(residue number reindexed from 1)		Q20 T21 T50 K51 T52 K54
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7lv9, PDBe:7lv9, PDBj:7lv9
PDBsum7lv9
PubMed33927388
UniProtD2XB49

[Back to BioLiP]