Structure of PDB 7lmb Chain D Binding Site BS01

Receptor Information
>7lmb Chain D (length=187) Species: 5911 (Tetrahymena thermophila) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QRIYSSIEEIIQQAQASEIGQKKEFYVYGNLVSIQMKNKLYYYRCTCQGK
SVLKYHGDSFFCESCQQFINPQVHLMLRAFVQDSTGTIPVMIFDQQSSQL
INQIDPSIHVQEAGQYVKNCIENGQEEIIRQLFSKLDFARFIFEIQFENK
EFNNEQEIAYKVLKIEKENIKEESKYLLKKLEHLINN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7lmb Structures of telomerase at several steps of telomere repeat synthesis.
Resolution3.8 Å
Binding residue
(original residue number in PDB)		Y552 F603 K660 F662 E667
Binding residue
(residue number reindexed from 1)		Y42 F93 K150 F152 E157
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0008270 zinc ion binding
GO:0043047 single-stranded telomeric DNA binding
GO:0046872 metal ion binding
Biological Process
GO:0007004 telomere maintenance via telomerase
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005694 chromosome
GO:0005697 telomerase holoenzyme complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7lmb, PDBe:7lmb, PDBj:7lmb
PDBsum7lmb
PubMed33981033
UniProtD2CVN6|TEB1_TETTS Telomeric repeat-binding subunit 1 (Gene Name=TEB1)

[Back to BioLiP]