Structure of PDB 7lar Chain D Binding Site BS01

Receptor Information

>7lar Chain D (length=183) Species: 85708 (Porcine circovirus 2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

LSTAVSTLLESGSLVTVAEQHPVTFVRNFRGLAELLKVSGKMQKRDWKTN
VHVIVGPPGCGKSKWAANFADPETTYWKPPRNKWWDGYHGEEVVVIDDFY
GWLPWDDLLRLCDRYPLTVETKGGTVPFLARSILITSNQTPLEWYSSTAV
PAVEALYRRITSLVFWKNATEQSTEEGGQFVTL

Ligand information

>7lar Chain G (length=6) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tttttt

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7lar Mechanism of DNA Interaction and Translocation by the Replicase of a Circular Rep-Encoding Single-Stranded DNA Virus.
Resolution	3.8 Å
Binding residue (original residue number in PDB)	W202 K240
Binding residue (residue number reindexed from 1)	W84 K122

Enzymatic activity

Enzyme Commision number

3.6.4.-

Gene Ontology

	Molecular Function
GO:0000166	nucleotide binding
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003724	RNA helicase activity
GO:0004519	endonuclease activity
GO:0016779	nucleotidyltransferase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006260	DNA replication

	Cellular Component
GO:0042025	host cell nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7lar, PDBe:7lar, PDBj:7lar
PDBsum	7lar
PubMed	34311576
UniProt	Q6TC59

[Back to BioLiP]