Structure of PDB 7kra Chain D Binding Site BS01

Receptor Information
>7kra Chain D (length=68) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EWAKHLLDTKYIEKYNIQMFMYIVFQGVLMYIGYRKLNSMGLIPNAKGDW
LPWERIAHYNNGLQWFSD
Ligand information
>7kra Chain M (length=21) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kra Structural and mechanistic basis of the EMC-dependent biogenesis of distinct transmembrane clients.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		Q148 L159
Binding residue
(residue number reindexed from 1)		Q26 L37
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0032977 membrane insertase activity
Biological Process
GO:0006644 phospholipid metabolic process
GO:0015914 phospholipid transport
GO:0034975 protein folding in endoplasmic reticulum
GO:0045050 protein insertion into ER membrane by stop-transfer membrane-anchor sequence
Cellular Component
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0016020 membrane
GO:0072546 EMC complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7kra, PDBe:7kra, PDBj:7kra
PDBsum7kra
PubMed33236988
UniProtP53073|EMC4_YEAST ER membrane protein complex subunit 4 (Gene Name=EMC4)

[Back to BioLiP]