Structure of PDB 7kpu Chain D Binding Site BS01

Receptor Information
>7kpu Chain D (length=195) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEP
ATVDWAFDLTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSV
PVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQ
MKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSCSYEILSRRT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kpu Novel Bisubstrate Inhibitors for Protein N-Terminal Acetyltransferase D.
Resolution1.43 Å
Binding residue
(original residue number in PDB)		Y85 W90 D127 E129 Y136 Y138 E139 T174 P199 Y211
Binding residue
(residue number reindexed from 1)		Y68 W73 D110 E112 Y119 Y121 E122 T157 P182 Y188
Enzymatic activity
Enzyme Commision number 2.3.1.257: N-terminal L-serine N(alpha)-acetyltransferase NatD.
Gene Ontology
Molecular Function
GO:0010485 histone H4 acetyltransferase activity
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
GO:0043998 histone H2A acetyltransferase activity

View graph for
Molecular Function
External links
PDB RCSB:7kpu, PDBe:7kpu, PDBj:7kpu
PDBsum7kpu
PubMed34110812
UniProtQ86UY6|NAA40_HUMAN N-alpha-acetyltransferase 40 (Gene Name=NAA40)

[Back to BioLiP]