Structure of PDB 7kld Chain D Binding Site BS01

Receptor Information
>7kld Chain D (length=106) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MITVDITVNDEGKVTDVIMDGHADHGEYGHDIVCAGASAVLFGSVNAIIG
LTSERPDINYDDNGGHFHIRSVDTNNDEAQLILQTMLVSLQTIEEEYNEN
IRLNYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7kld Phage-Related Ribosomal Protease (Prp) of Staphylococcus aureus : In Vitro Michaelis-Menten Kinetics, Screening for Inhibitors, and Crystal Structure of a Covalent Inhibition Product Complex.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		I32 T92 Y97
Binding residue
(residue number reindexed from 1)		I32 T92 Y97
Enzymatic activity
Enzyme Commision number 3.4.22.-
Gene Ontology
Molecular Function
GO:0008234 cysteine-type peptidase activity
Biological Process
GO:0006508 proteolysis
GO:0042254 ribosome biogenesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7kld, PDBe:7kld, PDBj:7kld
PDBsum7kld
PubMed35731716
UniProtQ2FXS9|PRP_STAA8 Ribosomal processing cysteine protease Prp (Gene Name=prp)

[Back to BioLiP]