Structure of PDB 7jwp Chain D Binding Site BS01

Receptor Information

>7jwp Chain D (length=216) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIVMTQTPSSTSAAVGGTVTITCQASQSVANNNYLKWYQQKRGQPPKQLI
YSVSTLASGVPSRFKGSGSGTQFTLTISDLEADDAATYYCSGYFNNNIGA
FGGGTKLEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQ
WKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVT
HQGLSSPVTKSFNRGE

Ligand information

>7jwp Chain R (length=6) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GDLESD

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7jwp Discovery of a caspase cleavage motif antibody reveals insights into noncanonical inflammasome function.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	A30 Y34 Y93 N97
Binding residue (residue number reindexed from 1)	A30 Y34 Y93 N97

External links

PDB	RCSB:7jwp, PDBe:7jwp, PDBj:7jwp
PDBsum	7jwp
PubMed	33723046

[Back to BioLiP]