Structure of PDB 7jfo Chain D Binding Site BS01

Receptor Information
>7jfo Chain D (length=138) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MMVWTPVNNKMFETFSYLPPLSDEQIAAQVDYIVANGWIPCLEFAESDKA
YVSNESAIRFGSVSCLYYDNRYWTMWKLPMFGCRDPMQVLREIVACTKAF
PDAYVRLVAFDNQKQVQIMGFLVQRPKSARDWQPANKR
Ligand information
>7jfo Chain r (length=22) Species: 3055 (Chlamydomonas reinhardtii) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
RVSPTRSVLPANWRQELESLRN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7jfo The structural basis of Rubisco phase separation in the pyrenoid.
Resolution2.13 Å
Binding residue
(original residue number in PDB)		D23 A28 D31 Y32 A35 N36 W38 M87 R91 V94
Binding residue
(residue number reindexed from 1)		D23 A28 D31 Y32 A35 N36 W38 M87 R91 V94
Enzymatic activity
Enzyme Commision number 4.1.1.39: ribulose-bisphosphate carboxylase.
Gene Ontology
Molecular Function
GO:0016984 ribulose-bisphosphate carboxylase activity
Biological Process
GO:0009853 photorespiration
GO:0015977 carbon fixation
GO:0015979 photosynthesis
GO:0019253 reductive pentose-phosphate cycle
Cellular Component
GO:0009507 chloroplast
GO:0009570 chloroplast stroma

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jfo, PDBe:7jfo, PDBj:7jfo
PDBsum7jfo
PubMed33230314
UniProtP08475|RBS2_CHLRE Ribulose bisphosphate carboxylase small subunit, chloroplastic 2 (Gene Name=RBCS2)

[Back to BioLiP]