Structure of PDB 7ezm Chain D Binding Site BS01

Receptor Information

>7ezm Chain D (length=304) Species: 9606 (Homo sapiens)

EWQPAVQILLYSLIFLLSVLGNTLVITVLIRNKRMRTVTNIFLLSLAVSD
LMLCLFCMPFNLIPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISL
ERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTK
NNNQTANMCRFLLPNDVMQQSWHTFLLLILFLIPGIVMMVAYGLISLELY
QGIKFEASQKKSNRIRSNSSAANLMAKKRVIRMLIVIVVLFFLCWMPIFS
ANAWRAYDTASAERRLSGTPISFILLLSYTSSCVNPIIYCFMNKRFRLGF
MATF

Ligand information

>7ezm Chain P (length=8) Species: 9606 (Homo sapiens)

DYMGWMDF

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7ezm Ligand recognition and G-protein coupling selectivity of cholecystokinin A receptor
• Resolution: 2.9 Å
• Binding residue (original residue number in PDB): P101 K105 G122 V125 Y176 C196 R197 F198 H210 N333 R336 E344 L347 S348 I352 Y360
• Binding residue (residue number reindexed from 1): P64 K68 G85 V88 Y139 C159 R160 F161 H173 N252 R255 E263 L266 S267 I271 Y279

Gene Ontology

Molecular Function

• GO:0004930 G protein-coupled receptor activity
• GO:0004951 cholecystokinin receptor activity
• GO:0017046 peptide hormone binding
• GO:0042277 peptide binding

Biological Process

• GO:0001764 neuron migration
• GO:0007186 G protein-coupled receptor signaling pathway
• GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
• GO:0007409 axonogenesis
• GO:0030900 forebrain development
• GO:0032870 cellular response to hormone stimulus
• GO:0038188 cholecystokinin signaling pathway
• GO:0046883 regulation of hormone secretion

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:7ezm, PDBe:7ezm, PDBj:7ezm
• PDBsum: 7ezm
• UniProt: P32238|CCKAR_HUMAN Cholecystokinin receptor type A (Gene Name=CCKAR)