Structure of PDB 7emc Chain D Binding Site BS01

Receptor Information
>7emc Chain D (length=275) Species: 9823 (Sus scrofa) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPRMEPRAP
WIQQEGQDYWDRETRKQRDTSQTYRVGLKNLRGYYNQSEAGSHTYQSMYG
CYLGPDGLLLRGYRQYAYDGADYIALNEDLRSWTAADTAAQITKRKWETA
NVAERRRSYLQGLCVESLREYLEMGKDTLQRAEPPKTHVTRHPSSDLGVT
LRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVP
PGEEQSYTCHVQHEGLQEPLTLRWD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7emc Mooring Stone-Like Arg 114 Pulls Diverse Bulged Peptides: First Insight into African Swine Fever Virus-Derived T Cell Epitopes Presented by Swine Major Histocompatibility Complex Class I.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Y7 E63 K66 Q67 T73 Y74 V76 G77 Y84 Y99 R114 Y116 T143 K146 R156 Y159 L163 S167 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 K66 Q67 T73 Y74 V76 G77 Y84 Y99 R114 Y116 T143 K146 R156 Y159 L163 S167 Y171
Enzymatic activity
Enzyme Commision number ?
External links